PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 253aa    MW: 28911.3 Da    PI: 6.5306
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1061genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+ +v+ +G g+W+++ar  g++R++k+c++rw++yl
      Gh_A08G1061 13 KGPWTEEEDYMLKTYVNVHGEGSWNSVARLSGLKRSGKSCRLRWLNYL 60
                     79********************************************97 PP

2Myb_DNA-binding46.58.8e-1566109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + +E++l+++++ ++G++ W++Ia+ ++ gRt++++k++w++
      Gh_A08G1061  66 RGNISLQEQLLILQLHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 109
                      788899****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.318864IPR017930Myb domain
SuperFamilySSF466891.68E-3010107IPR009057Homeodomain-like
SMARTSM007172.9E-151262IPR001005SANT/Myb domain
PfamPF002491.3E-161360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-211467IPR009057Homeodomain-like
CDDcd001679.93E-111560No hitNo description
SMARTSM007174.0E-1365113IPR001005SANT/Myb domain
PROSITE profilePS5129417.68465115IPR017930Myb domain
PfamPF002491.2E-1366109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2168113IPR009057Homeodomain-like
CDDcd001673.85E-686109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MTPQSKEDMD VRKGPWTEEE DYMLKTYVNV HGEGSWNSVA RLSGLKRSGK SCRLRWLNYL  60
RPEVKRGNIS LQEQLLILQL HSRWGNRWSK IAQQLPGRTD NEIKNYWRTR VLKQAKQLKC  120
DVNSQEFRDT MRCVWIPRLI ERICASSGSP SAQPSTAYEK TSLLPALSGT SSDSQDAELS  180
SVSDLTDCYN PPSNSNNPNS LQNGRGLWSE NLGGTWNIED GVGFQATEGG ESMESVWNEE  240
NIWFLRQQLY DMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-251010724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.34210.0ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475006.11e-168PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE13e-68MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2QXN91e-168A0A0D2QXN9_G
STRINGPOPTR_0002s19250.14e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.16e-72myb domain protein 78